DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33647 and CG14492

DIOPT Version :9

Sequence 1:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:96 Identity:29/96 - (30%)
Similarity:47/96 - (48%) Gaps:2/96 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YAEFILTQDVEDLKGIYILTFKRGSYVTNFTSSHV--DYCQMLSSVENHFLFRMVTTQLRETANF 123
            :.||:|.|.|.:......:...|...:.:|...:|  |.||:|::.....|.|:....:...:||
  Fly    68 HMEFVLEQPVAEHDFFIKIVLPRRRPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNF 132

  Fly   124 PIQCPLKMNKRYYAKGFTVNSKFIPSYMPET 154
            |.|||.|.|..||.:||.::...:|:...||
  Fly   133 PKQCPFKPNFTYYIRGFRLDLNLVPAVDMET 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33647NP_001027136.1 DUF1091 <95..156 CDD:284008 22/62 (35%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.