DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33647 and CG13193

DIOPT Version :10

Sequence 1:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:158 Identity:38/158 - (24%)
Similarity:66/158 - (41%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SVRAEKEVFMTKIECLNYMPEL---VRNVS--CYLNETSHPTGSIYAEFILTQDV---EDLKG-- 75
            |.:|.:::...:|..|.:.|.|   ..|:|  |..:..|...|.:.|:..|..|:   ..||.  
  Fly    12 SPQAHQDLIQIQISALRFGPTLRSKFTNISVECSKDYCSSIRGWLTAKGELNLDIHLNRTLKNGL 76

  Fly    76 ---IYILTFKRGS--YVTNFTSSHVDYCQMLSSVENHFLFRMVTTQLRETANFPIQCPLKMNKRY 135
               |.:|....|.  |.|.| |..:|.|:.|..:....|.::....:.:..|...:||:: ...|
  Fly    77 RTTITLLQLIDGKDRYQTLF-SYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQ-PASY 139

  Fly   136 YAKGFTVNSKFIPSYMP-------ETNF 156
            ..:.|.:.:..||.|:|       :||:
  Fly   140 DVRNFQLENHSIPGYLPAGFYRLHDTNY 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33647NP_001027136.1 DUF1091 <95..156 CDD:461928 14/67 (21%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 19/79 (24%)

Return to query results.
Submit another query.