DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33647 and CG33467

DIOPT Version :10

Sequence 1:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:130 Identity:25/130 - (19%)
Similarity:54/130 - (41%) Gaps:22/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TKIECLNYMPELVRNVSCYLNETSHPTGSIYAEFILTQDVEDLKGIYIL---TFKRGSYVTNFTS 92
            ||:||...... |:||||.:...:..|..:..:..|         ||.|   |.:...::.::::
  Fly    27 TKVECQGNQAR-VKNVSCNVKPINWNTALVNLDCYL---------IYPLINPTIRVQVFMKDYSN 81

  Fly    93 SH----VDYCQMLSSV---ENHFLFRMVTTQLRETANFPIQCPLKMNKRYYAKGFTVNSKFIPSY 150
            .:    :|....|..|   :|...:.::..:|.:.......|  .::.:..|:...:||.::|.:
  Fly    82 QYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVKSC--HISGQLSARNGYLNSSYVPPF 144

  Fly   151  150
              Fly   145  144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33647NP_001027136.1 DUF1091 <95..156 CDD:461928 10/59 (17%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:461928 10/77 (13%)

Return to query results.
Submit another query.