DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33647 and CG33475

DIOPT Version :10

Sequence 1:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster


Alignment Length:118 Identity:28/118 - (23%)
Similarity:46/118 - (38%) Gaps:36/118 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 FTSSHVDYC---------QMLSSV---ENHFLFRMVTTQLRETANFPIQ----CPLKMNKRYYAK 138
            :..|:|||.         .|::|.   :|.||...:...:.....:.|:    |.. :|.|..:|
  Fly    12 YNRSNVDYFGLVPGESQKMMINSTKLFKNIFLDNRIQNAVSNRTIYNIKNLAICNF-LNNRLISK 75

  Fly   139 -------GFTVNSK-FIPSYMPETNFISDAHLSVKDRKV--------FRLLIK 175
                   ||..||. |.....|...::|:   ||::.:|        |||.:|
  Fly    76 VYSVIYEGFVGNSTVFRCPVQPSVYYLSN---SVREFEVPIFHQPGMFRLYVK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33647NP_001027136.1 DUF1091 <95..156 CDD:461928 19/84 (23%)
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 16/73 (22%)

Return to query results.
Submit another query.