DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33647 and CG33483

DIOPT Version :10

Sequence 1:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:173 Identity:39/173 - (22%)
Similarity:60/173 - (34%) Gaps:38/173 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNVK-KLFILVDLILGTLILSSVRAEKEVF-MTKIECLNYMPELVRNVSCYLNETSHPTGSIYAE 63
            |:|| ||.|:|       |..||......| .|.|:|.:...:......|:|...:.....|..:
  Fly     1 MSVKYKLLIIV-------IFHSVNMSTSDFEFTNIKCTSLDKDFDDFEYCHLKSVNRTFKYISVK 58

  Fly    64 FILTQDVEDLKGIYILTFKRGSYV--TNFTSSHVD-------YCQMLSSVENHFLFRMVTTQLRE 119
            ..:.:       |.:...|..|.|  ||...:..|       ||. |.||...|.:..:...|.:
  Fly    59 VRMYK-------IPVTKVKIASLVEFTNIKCTSWDKAFDDFEYCH-LKSVNRSFKYLSLKVNLHK 115

  Fly   120 TANFPIQCPLKMNKRYYA-KGFTVN-----------SKFIPSY 150
            .....::....:.||:.. |.|..|           ||:.|.:
  Fly   116 VPITKVKVNFSLLKRFNGYKPFLYNITVDACKALRHSKYNPIF 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33647NP_001027136.1 DUF1091 <95..156 CDD:461928 16/75 (21%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:461928 8/36 (22%)

Return to query results.
Submit another query.