DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG14455

DIOPT Version :9

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster


Alignment Length:164 Identity:42/164 - (25%)
Similarity:84/164 - (51%) Gaps:21/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EMLKVCTLVSIIFVHKLAITGA--AGKSNFSPTYFE------NFTLEIQNNT----LFMDMTTSK 68
            |:::.|..|:.|.|..:.:|||  :.|...:...||      :..:::||::    |.:|:.|.:
  Fly     4 EVIRSCCAVAFILVALMPLTGAWRSFKVILTSIDFEANDKFLDLKVDLQNDSGESNLSIDIKTHQ 68

  Fly    69 PIHRGLKVLLNTQISLDKGRSYQRLFAHILDTCGVVSSVRGN-LFKSWFDSMLKHGNFMVNCPVP 132
            .| ..::::::..:..||| :|..|....|:.|.::.....: |.::.::.:||||.....||:.
  Fly    69 DI-EDVQLVVDFGLETDKG-NYSTLINRTLNFCKLMKQRNSDPLVRAIYEDLLKHGTLFKECPIR 131

  Fly   133 AGHYFLRDWKLDSHLVPHYMLPGDYCITAHFFFG 166
            :|.|.|.::.:|..::|.: ||     .|.|.||
  Fly   132 SGTYSLTNYNVDEEMLPSF-LP-----EAKFRFG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 22/78 (28%)
CG14455NP_649402.2 DM8 87..179 CDD:214778 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.