DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG12849

DIOPT Version :10

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:164 Identity:34/164 - (20%)
Similarity:62/164 - (37%) Gaps:45/164 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IIFVHKLAITGAAGKSNFSPTYFE-NFTLEIQNNTLFMDMTTS--KPIHRGLKVL-LNT------ 80
            :||:..:||.|          :|| |..:.:..:.:|||....  |.::|..|.| |.|      
  Fly     9 LIFMSPMAIRG----------HFEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLP 63

  Fly    81 --------QISLDKGRSYQRLFAHILDTCGVVSSVRGNLFKSW-FDSMLKHGNFMVNCP------ 130
                    |:.:.:.|.....|...:|:|..:.. |.::..:| :.:...:.|....||      
  Fly    64 VDNCETRFQLRMRENRRVLYNFDFKVDSCKFMRD-RKHVIANWVYQTFGPYSNLNHTCPYDHDIV 127

  Fly   131 ---VPAGHYFLRDWKLDSHLVP--HYMLPGDYCI 159
               :|..|..    ||...::|  .||:...:.:
  Fly   128 LDKLPVQHLN----KLVQSIIPDGRYMMNSTWMV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 15/82 (18%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 15/83 (18%)

Return to query results.
Submit another query.