DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG33923

DIOPT Version :10

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:101 Identity:22/101 - (21%)
Similarity:41/101 - (40%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KVLLNTQISLDKGRSYQRLFAHI-LDTCGVVSSVRGNLFKSWFDSMLK-HGNFMVNCP------- 130
            |:.:|..| |.:...|:....:: :|.|....:.:.|....:..|..| :.|...:||       
  Fly    69 KIKINVAI-LQRLNGYKPFLYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDIIV 132

  Fly   131 --VPAGHYFLRDWKLDSHLVPHYMLPGDYCITAHFF 164
              :|..|...:..|:..  |||    |||...::::
  Fly   133 EKLPISHVNTQVTKVLP--VPH----GDYLFHSNWY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 18/86 (21%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:461928 21/91 (23%)

Return to query results.
Submit another query.