DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG33757

DIOPT Version :9

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster


Alignment Length:137 Identity:26/137 - (18%)
Similarity:51/137 - (37%) Gaps:22/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SNFSPTYFENFTLEIQ-----NNTL---FMDMTTSKPIHRGLKVLLNTQISLDKGRSYQRLFAHI 97
            :|:..:|.|....:|:     .|::   |..:.|...:|..|::       ..:...::....:|
  Fly    28 TNYDRSYGEILLCKIKAINRYRNSISIQFRQLRTVNNVHMRLEL-------FKRANGWRPFLYNI 85

  Fly    98 -LDTCGVVSSVRGNLFKSWFDSMLKHGNFMVN--CPVPAGHYFL---RDWKLDSHLVPHYMLPGD 156
             .:.|..:|. |.|:..|.....||....|.|  ||....|...   .::.::...|...:..|:
  Fly    86 SFNLCDFLSK-RNNVIVSLGYEYLKPYIPMTNYTCPFKKNHLIKCTDLEFDIEKFRVRFPIETGE 149

  Fly   157 YCITAHF 163
            |.:...|
  Fly   150 YALQLSF 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 17/80 (21%)
CG33757NP_001027398.1 DUF1091 67..152 CDD:284008 17/92 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.