DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG33658

DIOPT Version :9

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster


Alignment Length:93 Identity:21/93 - (22%)
Similarity:36/93 - (38%) Gaps:24/93 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RHHYSLDISIEMLKVCTLVSI------------IFVHKLAITGAA----GKSNFSPTYFENFTLE 54
            |.:..|...|::||:...:.:            .|::.:.|.|..    .|||....||.:|...
  Fly    55 RTYQYLSTRIKVLKLLNSLKVNFGLHQQINGYKPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRN 119

  Fly    55 IQ--------NNTLFMDMTTSKPIHRGL 74
            |.        |:.:.|:..||:.|:..|
  Fly   120 ISNLNHSCPYNHDIIMEKLTSETINSRL 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 16/64 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.