DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG33912

DIOPT Version :9

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster


Alignment Length:142 Identity:35/142 - (24%)
Similarity:50/142 - (35%) Gaps:32/142 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IIFVHKLAITGAAGKSNFSPTYFENFTLE-IQNNTLFMDMTTSKPIHRGLKV------LLNTQIS 83
            |:|:..|..:.......:|...|.|...| :..:...::....|.::|..|.      ||...||
  Fly     6 ILFISFLMYSTCYFTEVYSLVEFANVQCESLDKDFALIEYCYLKSVNRSYKYVSIKVNLLKLPIS 70

  Fly    84 LDKGR--SYQR-------LFAHILDTCGVVSSVRGNLFKSWF-------DSMLKHGNFMVN---- 128
            ..|.|  .|:|       |:...||.|..:.|...|....:|       |.|..|.   ||    
  Fly    71 KVKIRFGLYKRFTGYKPFLYNATLDACKFLKSPNSNPVALFFIIHDIVLDKMSYHS---VNNKLT 132

  Fly   129 --CPVPAGHYFL 138
              .|.|.|||.:
  Fly   133 KILPFPEGHYMI 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 19/69 (28%)
CG33912NP_001027139.1 DUF1091 74..144 CDD:284008 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.