DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG33771

DIOPT Version :9

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster


Alignment Length:177 Identity:70/177 - (39%)
Similarity:110/177 - (62%) Gaps:10/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EMLKVCTLVSIIF-------VHKLAITGAAGKSNFSPTYFENFTLEIQNNTLFMDMTTSKPIHRG 73
            ::|.:..||.::|       |.:|.:|   |.|:::|.||:|||:.|.|||:.|||..::||.||
  Fly     3 KLLTLFLLVQLVFKTEIVVGVSQLFVT---GNSSYNPKYFKNFTITIANNTMNMDMHLNRPIQRG 64

  Fly    74 LKVLLNTQISLDKGRSYQRLFAHILDTCGVVSSVRGNLFKSWFDSMLKHGNFMVNCPVPAGHYFL 138
            .|..::..:.|...:::|.:|:...|.|.|.|||:.:||||||..|.|:.|||.||||..|||::
  Fly    65 FKAHVDILLRLANAKNFQSMFSQKSDVCAVTSSVKNSLFKSWFKDMSKNSNFMYNCPVEVGHYYM 129

  Fly   139 RDWKLDSHLVPHYMLPGDYCITAHFFFGKHKSKQEEFFLDLEVYALL 185
            .||::.|.:...:::||:|.....||:||:.:|..|..|.|.:.|:|
  Fly   130 HDWRMGSSMTHKFLIPGEYRGKLTFFYGKYGTKLFEEALSLTIDAIL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 39/89 (44%)
CG33771NP_001027145.3 DM8 80..171 CDD:214778 39/90 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463889
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.