DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG33758

DIOPT Version :9

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:132 Identity:28/132 - (21%)
Similarity:42/132 - (31%) Gaps:34/132 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ISIEMLKVCTLVSIIFVHKLAITGAAGKSNFSPTYFENFTLEI-----QNNTLFMDMTTSKPIHR 72
            ||:: .|:...||.||:.......|.|   :.| :..|||..:     :||.:.|          
  Fly    51 ISVQ-YKLKQPVSKIFIRLEFFKRANG---WRP-FLYNFTANLCDFLARNNNVIM---------- 100

  Fly    73 GLKVLLNTQISLDKGRSYQRLFAHILDTCGVVSSVRGNLFKSWFDSMLKHGNFMVNCPVPAGHYF 137
                          |..|..|..:::........|..|......|..|...|.....|:..|.|.
  Fly   101 --------------GIGYAYLRPYLVKNYSCPFKVIENELLECKDFELDINNLRNRFPIETGEYA 151

  Fly   138 LR 139
            |:
  Fly   152 LQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 11/50 (22%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:284008 20/113 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.