DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG33766

DIOPT Version :9

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster


Alignment Length:146 Identity:42/146 - (28%)
Similarity:80/146 - (54%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ISIEMLKVCTLVSIIFVHK-LAITGAAGKSNFSPTYFENFTLEIQNNTLFMDMTTSKPIHRGLKV 76
            :||.|..:|.::..|..:| |.:....|  ||:.:||.|||:.::|:.:.|:....:.:..|:.:
  Fly     6 LSISMSLICLIIVPIPTNKILLLESQCG--NFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPGVTM 68

  Fly    77 LLNTQISLDKGRSYQRLFAHILDTCGVVSSVRGNLFKSWFDSMLKHGNFMVNCPVPAGHYFLRDW 141
            .:...||:.....:|::|.:.||.|.:::..|.|:||.||.:....|||...|||....|:|:::
  Fly    69 DIEFFISMQNSYGFQKIFQYTLDMCSLLAQRRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNY 133

  Fly   142 KLDSHLVPHYMLPGDY 157
            ..::..:|.::..|.|
  Fly   134 NYNTLFIPKFLYAGKY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 22/68 (32%)
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463900
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.