DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG33641

DIOPT Version :9

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster


Alignment Length:139 Identity:30/139 - (21%)
Similarity:59/139 - (42%) Gaps:24/139 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YFENFTLEIQNNTLF--MDMTTSKPIHRGLKVLLNTQISLDK-----------------GRSYQR 92
            :|:.|.::.:...:|  ||....:..:|.   .:|.::.|.|                 .::..:
  Fly    27 FFDEFAIKYKVPDIFEKMDCNLYQANNRS---YVNVEMKLKKEVSDLNVRAIMEFWKPNAQNKMK 88

  Fly    93 LFAHILDTCGVVSSVRGN-LFKSWFDSMLKHGNFMVNCPVPAGH-YFLRDWKLDSHLVPHYMLPG 155
            |:...:|.|.::.::..| ||..:..|..||.|.:::||..|.. |.:.||.||...:|.:...|
  Fly    89 LYDVRVDGCLILRTIHKNKLFYFYVKSFKKHSNVVLSCPFKANFTYKMDDWFLDEEELPPFAPVG 153

  Fly   156 DYCITAHFF 164
            .:.....:|
  Fly   154 QFRTVTEYF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 21/77 (27%)
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 20/75 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.