DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG33922

DIOPT Version :10

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:115 Identity:31/115 - (26%)
Similarity:41/115 - (35%) Gaps:41/115 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 KPIHR-----GLKV-LLNTQISLDKGR--SYQRLFAH-------ILDTCGVVSSVRGNLFKSWFD 117
            |.::|     .||| ||.|.:|..|..  ::|||..:       .:|.|......|.|...|:|.
  Fly    47 KSVNRTYKYYSLKVKLLKTPVSNVKINIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFF 111

  Fly   118 SMLK-----------------------HGNFMVN--CPVPAGHYFLR-DW 141
            :..|                       |.|..|.  .|||.|:|..| ||
  Fly   112 NFFKDYSNINHSCPYDHDIILDKVSISHANTQVTNVLPVPHGNYLYRADW 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 21/85 (25%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:461928 17/83 (20%)

Return to query results.
Submit another query.