DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG33768

DIOPT Version :9

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster


Alignment Length:172 Identity:54/172 - (31%)
Similarity:101/172 - (58%) Gaps:3/172 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MLKVCTLVSIIFVHKL---AITGAAGKSNFSPTYFENFTLEIQNNTLFMDMTTSKPIHRGLKVLL 78
            |||:..::.:|||.:.   ::|....:...:..:|....:...|:|::.|:...:.:..|.:..:
  Fly     1 MLKIVCVLMVIFVSQAVSSSVTLNRVQCEKNAKFFATLNVTSVNSTIYADIELLQALKAGFRGHV 65

  Fly    79 NTQISLDKGRSYQRLFAHILDTCGVVSSVRGNLFKSWFDSMLKHGNFMVNCPVPAGHYFLRDWKL 143
            :.|:.|...:.:|.|.....|.|.::|:::.:||:.|..|:.|:.|||.|||||||||:|:.|.:
  Fly    66 DVQLRLSNAKKFQSLVQADTDYCELLSTLKDSLFRRWIKSVSKNSNFMENCPVPAGHYYLKGWHV 130

  Fly   144 DSHLVPHYMLPGDYCITAHFFFGKHKSKQEEFFLDLEVYALL 185
            :..|||.|:|.|||.::|..::||::||::.|.:...|.|.:
  Fly   131 EMGLVPSYLLSGDYLLSALVYYGKYRSKKQMFLVRCMVEATM 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 38/89 (43%)
CG33768NP_001027142.2 DM8 76..167 CDD:214778 38/90 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463893
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.