DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG33689

DIOPT Version :10

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster


Alignment Length:160 Identity:29/160 - (18%)
Similarity:60/160 - (37%) Gaps:38/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLDISIEMLKVCTLVSIIFVHKLAITGAAGKSNFSPTYFENFTLEIQNNTLFMDMTTSKPIHRGL 74
            |.|.:..:.|.|.:.::...||           :...|...:.|.|.|.|:...:          
  Fly    30 SKDPTFAIFKKCFIKAVNRTHK-----------YVDVYVNLYKLPIDNITISFRL---------- 73

  Fly    75 KVLLNTQISLDKGRSYQRLFA-HILDTCGVVSSVRGNLFKSWFDSMLKHGNFMVNCPVPAGHYFL 138
                   :..|.|  |:..|. :..|.|..:.:.:..:.|.::  .:..|:..:|...|..|..:
  Fly    74 -------MRHDHG--YKPFFIDYTFDGCKFLRNQKHPIIKLFY--KIYQGSSNINHTCPYDHDII 127

  Fly   139 RD--W--KLDSHLVPHY-MLPGDYCITAHF 163
            .|  |  .::|..:.:. |:.|||.:.:::
  Fly   128 VDHLWTGNIESDFLKYIPMINGDYAVYSNW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 16/80 (20%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 18/100 (18%)

Return to query results.
Submit another query.