DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG33137

DIOPT Version :10

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:109 Identity:22/109 - (20%)
Similarity:39/109 - (35%) Gaps:27/109 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 MDMTTSKPIHRGLKVLLNTQI-SLDKGRSYQRLFAH-ILDTCGVVSSVRGNLFKSWFDSMLKHG- 123
            ||:...:|::   .:.:..|| ..|....:|..... :::.|..:|.          .|.:.:| 
  Fly    47 MDVYLLRPLY---NITIRFQILKKDYSNKFQPFLVDVVINMCDALSR----------RSFIPYGL 98

  Fly   124 ----------NFMVNCPVPAGHYFLRDWKLDSHLVPHYMLPGDY 157
                      ||..:||. .||...|...|:...:|:....|.|
  Fly    99 IILKIARTFSNFNHSCPY-RGHLMARGAYLNESYLPNVFPLGFY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 16/80 (20%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 16/80 (20%)

Return to query results.
Submit another query.