DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG13193

DIOPT Version :9

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:161 Identity:42/161 - (26%)
Similarity:78/161 - (48%) Gaps:21/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FSPTY---FENFTLEIQNN-------------TLFMDMTTSKPIHRGLKVLLNTQISLDKGRSYQ 91
            |.||.   |.|.::|...:             .|.:|:..::.:..||:..:.....:|....||
  Fly    29 FGPTLRSKFTNISVECSKDYCSSIRGWLTAKGELNLDIHLNRTLKNGLRTTITLLQLIDGKDRYQ 93

  Fly    92 RLFAHILDTCGVVSS-VRGNLFKSWFDSMLKHGNFMVNCPVPAGHYFLRDWKLDSHLVPHYMLPG 155
            .||::.:|||..:.. ::.:|.|.|..::.|:||....||:....|.:|:::|::|.:|.|:..|
  Fly    94 TLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYDVRNFQLENHSIPGYLPAG 158

  Fly   156 DYCITAHFFFGKHKSKQEE----FFLDLEVY 182
            .|.:....::||.|.:|..    |.||::.|
  Fly   159 FYRLHDTNYYGKPKGRQRRPVATFILDIKFY 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 30/94 (32%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 27/91 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463899
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.