DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33767 and CG33454

DIOPT Version :9

Sequence 1:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:145 Identity:34/145 - (23%)
Similarity:59/145 - (40%) Gaps:20/145 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPTYFENFTLEIQNNT---LFMDMTTSKPIHRGLKVLLNTQISLDKGRSYQR-LFAHILDTCGVV 104
            |.|.|....|:..:.|   |.::.|...||:   .:.:..|: |.:...|:. ||...:|.|..:
  Fly    38 SLTVFHYCRLKAYSRTKTSLHINATFLHPIN---SISVRFQM-LKRANGYKPFLFDITVDACQFL 98

  Fly   105 SSVRGNLFKSWFDSMLKHGNFMVNCPVPAGHYFLRDWKLDSHLVPHYMLP-GDYCITAHFFF-GK 167
            ......:.|..::.:....|...:||.  |...|.|:...|..:|   .| |||.....|.. ||
  Fly    99 RKPNNPVIKIVYNMIKDASNINHSCPY--GTVVLNDFHRISLPLP---FPSGDYLSRLDFLINGK 158

  Fly   168 HKSKQEEFFLDLEVY 182
            .|     |::::.::
  Fly   159 TK-----FYVNVNMH 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33767NP_001027141.1 DM8 90..180 CDD:214778 23/92 (25%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447966
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.