DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33839 and cpar-1

DIOPT Version :9

Sequence 1:NP_001027343.1 Gene:His3:CG33839 / 3772032 FlyBaseID:FBgn0053839 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_499073.1 Gene:cpar-1 / 186223 WormBaseID:WBGene00010036 Length:261 Species:Caenorhabditis elegans


Alignment Length:99 Identity:54/99 - (54%)
Similarity:70/99 - (70%) Gaps:3/99 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ---DFKTDLRFQSSAVMALQEAS 97
            :.|..|||||..||.|||:||:|.:|||.|.||.||||||.|   .|.:|||.:|.|:.||||||
 Worm   158 ISKTRRYRPGQKALEEIRKYQESEDLLIPKAPFARLVREIMQTSTPFSSDLRIRSDAINALQEAS 222

  Fly    98 EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRI 131
            ||.||.:|:.::|.:.|:||.|:...|:||.||:
 Worm   223 EALLVQMFDGSSLISAHSKRATLTTTDVQLYRRL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33839NP_001027343.1 PTZ00018 1..136 CDD:185400 54/99 (55%)
cpar-1NP_499073.1 Histone 132..257 CDD:278551 54/99 (55%)
H3 156..261 CDD:128705 54/99 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.