DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33839 and his-25

DIOPT Version :9

Sequence 1:NP_001027343.1 Gene:His3:CG33839 / 3772032 FlyBaseID:FBgn0053839 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_496895.1 Gene:his-25 / 175031 WormBaseID:WBGene00001899 Length:136 Species:Caenorhabditis elegans


Alignment Length:136 Identity:132/136 - (97%)
Similarity:135/136 - (99%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            ||||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||:
 Worm     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTELLIRR 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            .||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||
 Worm    66 APFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            ||||||
 Worm   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33839NP_001027343.1 PTZ00018 1..136 CDD:185400 130/134 (97%)
his-25NP_496895.1 PTZ00018 1..136 CDD:185400 130/134 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 251 1.000 Domainoid score I1147
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 259 1.000 Inparanoid score I1923
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 1 1.000 - - otm14556
orthoMCL 1 0.900 - - OOG6_100119
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R543
SonicParanoid 1 1.000 - - X183
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.