DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and Cd209f

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_001068161.4 Gene:Cd209f / 688750 RGDID:1585258 Length:277 Species:Rattus norvegicus


Alignment Length:49 Identity:13/49 - (26%)
Similarity:26/49 - (53%) Gaps:4/49 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 DSSSGAEKGCVILKQPTLKWMPEDCSAVKDFICEQ--TRCYYYNYGSIP 188
            :.::..::.||::.:.  ||....|||...::|||  |.|..:...::|
  Rat   231 EPNNAGDEDCVVIAED--KWNDSTCSANNFWVCEQPSTPCPGHARSALP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 8/33 (24%)
Cd209fXP_001068161.4 CLECT_DC-SIGN_like 143..262 CDD:153060 7/32 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.