powered by:
Protein Alignment nw and Cd209f
DIOPT Version :9
Sequence 1: | NP_001027435.2 |
Gene: | nw / 3772015 |
FlyBaseID: | FBgn0283508 |
Length: | 491 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001068161.4 |
Gene: | Cd209f / 688750 |
RGDID: | 1585258 |
Length: | 277 |
Species: | Rattus norvegicus |
Alignment Length: | 49 |
Identity: | 13/49 - (26%) |
Similarity: | 26/49 - (53%) |
Gaps: | 4/49 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 142 DSSSGAEKGCVILKQPTLKWMPEDCSAVKDFICEQ--TRCYYYNYGSIP 188
:.::..::.||::.:. ||....|||...::||| |.|..:...::|
Rat 231 EPNNAGDEDCVVIAED--KWNDSTCSANNFWVCEQPSTPCPGHARSALP 277
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22802 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.