powered by:
Protein Alignment nw and si:dkey-241l7.3
DIOPT Version :9
Sequence 1: | NP_001027435.2 |
Gene: | nw / 3772015 |
FlyBaseID: | FBgn0283508 |
Length: | 491 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021324414.1 |
Gene: | si:dkey-241l7.3 / 567766 |
ZFINID: | ZDB-GENE-041014-239 |
Length: | 162 |
Species: | Danio rerio |
Alignment Length: | 73 |
Identity: | 21/73 - (28%) |
Similarity: | 35/73 - (47%) |
Gaps: | 8/73 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 YSPELNYFLAYQYCRSLGLQLASFETKEKAESMTTYLKNAGYGNYDFWTSGNRLG--TGMFLWMS 101
:|..:|:..|.:.|:|||..|||...:.:.:.:.|.:. |:...|..|:. | .|.:|| |
Zfish 42 FSRSVNWVTAERNCQSLGGNLASVHDQVENDFLLTLVP----GSTRCWIGGHD-GEQDGQWLW-S 100
Fly 102 TGLPFNAT 109
.|..:..|
Zfish 101 DGSVYGYT 108
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
nw | NP_001027435.2 |
CLECT |
31..176 |
CDD:153057 |
21/73 (29%) |
si:dkey-241l7.3 | XP_021324414.1 |
CLECT |
27..126 |
CDD:214480 |
21/73 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1509611at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.