DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and si:ch73-86n18.1

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001038504.2 Gene:si:ch73-86n18.1 / 564061 ZFINID:ZDB-GENE-141216-19 Length:263 Species:Danio rerio


Alignment Length:171 Identity:34/171 - (19%)
Similarity:62/171 - (36%) Gaps:32/171 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLLSLLACAAGQRITTIHLDGVQYFISRMNPYSPELNYFLAYQYCRSLGLQLASFETKEKAESMT 72
            |..|::.|..... ..:||....|:.|     ..:|::..:.:.|.|:|..|....:.|:..::.
Zfish   114 CSKSVIKCRPCPE-DWMHLSEKCYYFS-----DDKLDWQHSKESCASMGGHLTILHSHEQHHTLE 172

  Fly    73 TYLKNAGYGNYDFWTSGNRLGT-GMFLWMSTGLPFNATFDFFENSADAIQAGLLDPVDHNSNTSP 136
            ...:|.|..:|.||...:...| |::.|:...:.....::.:|.          :|.:|.     
Zfish   173 AVARNHGGMDYHFWIGLSDTETEGVWKWVDNTVVNKTYWNEWEK----------EPNNHR----- 222

  Fly   137 QRTARDSSSGAEKG--CVILKQPTLKWMPEDCSAVKDFICE 175
                    ||...|  |.:|...:..|....|......|||
Zfish   223 --------SGGVHGEDCAVLDSRSKTWFDVPCDFHYKRICE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 29/148 (20%)
si:ch73-86n18.1NP_001038504.2 CLECT_DC-SIGN_like 124..256 CDD:153060 31/161 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.