DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment nw and si:ch211-225k7.6

DIOPT Version :9

Sequence 1:	NP_001027435.2	Gene:	nw / 3772015	FlyBaseID:	FBgn0283508	Length:	491	Species:	Drosophila melanogaster
Sequence 2:	NP_001093462.1	Gene:	si:ch211-225k7.6 / 558654	ZFINID:	ZDB-GENE-070705-121	Length:	359	Species:	Danio rerio

Alignment Length:	140	Identity:	24/140 - (17%)
Similarity:	51/140 - (36%)	Gaps:	38/140 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly    43 LNYFLAYQYCRSLGLQLASFETKEKAESMTTYLKNAGYGNYDFWTSGNRLGTGMF---LWMSTGL 104
            :|:..|..|||...:.|.|...:.:::.:..::.::.....|.|       .|:|   .|....
Zfish   136 MNWRAAQSYCRQNHIDLVSVRNQNESQQLEKFINDSIPSRSDVW-------IGLFRDWQWSDQS- 192

  Fly   105 PFNATFDFFENSADAIQAGLLDPVDHNSNTSPQRTARDSSSGAEKGCVILKQPTL-KWMPEDCSA 168
              |.:|.::..:         :|.::.:|               :.|.:||:.|. .|....|..
Zfish   193 --NYSFSYWNTN---------EPNNYGNN---------------ENCTVLKENTNGHWADISCDC 231

  Fly   169 VKDFICEQTR 178
            ...|:|.:.:
Zfish   232 QFPFVCHEDK 241

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
nw	NP_001027435.2	CLECT	31..176	CDD:153057	24/136 (18%)
si:ch211-225k7.6	NP_001093462.1	CLECT	23..124	CDD:295302
		CLECT	127..238	CDD:295302	23/135 (17%)
		CLECT	244..356	CDD:153057
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D605458at33208
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.920