DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and si:dkey-88n24.6

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001314972.1 Gene:si:dkey-88n24.6 / 555551 ZFINID:ZDB-GENE-041014-88 Length:368 Species:Danio rerio


Alignment Length:178 Identity:40/178 - (22%)
Similarity:60/178 - (33%) Gaps:47/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKIVLFCLLSLLACAAGQRITTIHLDGVQYFISRMNPYSPELNYFLAYQYCRSLGLQLASFETK 65
            ||:.:.|.|..:..|:..:.:..      ||.....|.     |:..|.:|||.....||:.:..
Zfish     1 MAQSLYFPLHLIALCSISECVQR------QYHFINENK-----NWTEAQRYCREKYTDLATVDNM 54

  Fly    66 EKAESMTTYLKNAGYGNYDFWTSGNRLGTGMFLW-MSTGLPFNATFDFFENSADAIQAGLLDPVD 129
            .....:.....|.|..|  .|....|  ||::.| .|:|.|     ..|.|.|....||      
Zfish    55 NDLIQLKKSANNEGVQN--IWIGLQR--TGVYKWYWSSGDP-----ALFLNWASGEPAG------ 104

  Fly   130 HNSNTSPQRTARDSSSGAEKGCVILKQPTLKWMPEDCSAVKDFICEQT 177
                              .:.|.:::..  :|:...||.|..|||..|
Zfish   105 ------------------SEECAVMRNG--QWIVWLCSNVSFFICNNT 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 33/145 (23%)
si:dkey-88n24.6NP_001314972.1 CLECT_1 23..129 CDD:153072 32/151 (21%)
CLECT_1 136..247 CDD:153072
CLECT 253..365 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.