DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and tfc

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster


Alignment Length:136 Identity:42/136 - (30%)
Similarity:59/136 - (43%) Gaps:26/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NYFLAYQYCRSLGLQLASFETKEKAESMTTYLKNAGYGNYDFWTSGNRLG-TGMFLWMSTGLPFN 107
            |:|.|.||||..|:.|||..::|:.:.:..::::.|.|:..||.||..|. .|.|.||:||.|..
  Fly   259 NWFKATQYCRYHGMHLASISSQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPIT 323

  Fly   108 ATFDFFENSADAIQAGLLDPVDHNSNTSPQRTARDSSSGAEKGCVIL---KQPTLKWMPEDCSAV 169
            .|                     |.|.......| ..:|.|:.|:.|   ....|||....||..
  Fly   324 FT---------------------NWNAGEPNNFR-YENGEEENCLELWNRDGKGLKWNDSPCSFE 366

  Fly   170 KDFICE 175
            ..|:||
  Fly   367 TYFVCE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 42/136 (31%)
tfcNP_612091.1 CLECT 249..373 CDD:153057 42/136 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.