DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and CG14500

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_611309.1 Gene:CG14500 / 37087 FlyBaseID:FBgn0034318 Length:190 Species:Drosophila melanogaster


Alignment Length:175 Identity:41/175 - (23%)
Similarity:60/175 - (34%) Gaps:64/175 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NYFLAYQYCRSLGLQLASFETKEKAESMTTYLKNAGYGNYDFWTSGNRL-GTGMFLWMSTG---- 103
            |::.:.::||||...|.|.....:...:..:|........:||||||:| ||..:.|.|||    
  Fly    51 NFYESDRHCRSLNAGLLSISNPTEFNVINEWLPIIAPYQPEFWTSGNKLGGTSDYYWQSTGQKAV 115

  Fly   104 -LPFNATFDFFENSADAIQAGLLDPVDHNSNTSPQRTARDSSSGAEKGCVILK------------ 155
             ||::|                         ..|..||.|        |:.|.            
  Fly   116 YLPWSA-------------------------GQPTTTAGD--------CLTLMANVTMTPEEAIL 147

  Fly   156 -------QPTLKWMPEDCSA----VKDFICEQTRCYYYNYGSIPV 189
                   :|..:|.|..|.|    .|..:|..|..::  ...|||
  Fly   148 SVHRLTVKPCTQWAPHICQAPLEIFKTQLCLNTTAFF--EAKIPV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 37/160 (23%)
CG14500NP_611309.1 CLECT 31..166 CDD:214480 33/147 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.