DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and CG14499

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001261072.3 Gene:CG14499 / 37086 FlyBaseID:FBgn0034317 Length:188 Species:Drosophila melanogaster


Alignment Length:200 Identity:47/200 - (23%)
Similarity:73/200 - (36%) Gaps:43/200 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIVLFCLLSL----LACAAGQRITTIHLDGVQYFISRMNPYSPELNYFLAYQYCRSLGLQLASFE 63
            |:|.|.|.||    |...|.:....:..........:...:......||. ::|:||...|.||.
  Fly     5 KLVCFALASLALGQLYLVASEETVAVCPTNFTQVAGKCLLFDNSWKNFLD-RHCQSLNAGLLSFS 68

  Fly    64 TKEKAESMTTYLKNAGYGNYDFWTSGNRL-GTGMFLWMSTG-----LPFNATFDFFENSADAIQA 122
            .|.:..::..:|......:.:.|||||:| |:..:.|.|||     ||:              ||
  Fly    69 NKMEFTAINEWLTTVVPQSPELWTSGNKLGGSEDYYWQSTGKKAFYLPW--------------QA 119

  Fly   123 GLLDPVD-------HNSNTSPQRTARDSSSGAEKGCVILKQPTLKWMPEDCSA----VKDFICEQ 176
            |...|:.       .|...:.:.|.......:.:||.       ||.|..|.|    .|..:|..
  Fly   120 GQPTPITGDCLTLLANVTMTAEGTTMSEHRLSVRGCT-------KWAPHVCQAPLQIFKTQLCLN 177

  Fly   177 TRCYY 181
            |..::
  Fly   178 TTAFF 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 38/161 (24%)
CG14499NP_001261072.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.