DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and RGD1564571

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_221808.5 Gene:RGD1564571 / 304197 RGDID:1564571 Length:207 Species:Rattus norvegicus


Alignment Length:136 Identity:29/136 - (21%)
Similarity:46/136 - (33%) Gaps:52/136 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CRSLGLQLASFETKEKAESM--TTYLK-NAGYGNYD-------FWTSGNRLGTGMFLWMSTGLPF 106
            |:.:|.||...::.|:...:  |:.:| |...|..|       .|..|:.|....: | |.|.| 
  Rat   108 CKDMGAQLVVIKSYEEQSFLQRTSKMKGNTWIGLSDSQEEDQWLWVDGSPLQWRNY-W-SAGEP- 169

  Fly   107 NATFDFFENSADAIQAGLLDPVDHNSNTSPQRTARDSSSGAEKGCVILKQPTLKWMPEDCSAVKD 171
            |..:|     .|.::.                    ||.|              |....||..|.
  Rat   170 NNLYD-----EDCVEF--------------------SSYG--------------WNDISCSFEKF 195

  Fly   172 FICEQT 177
            :||:::
  Rat   196 WICKKS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 29/133 (22%)
RGD1564571XP_221808.5 CLECT_DC-SIGN_like 80..200 CDD:153060 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.