Sequence 1: | NP_001027435.2 | Gene: | nw / 3772015 | FlyBaseID: | FBgn0283508 | Length: | 491 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036773.1 | Gene: | Reg1a / 24714 | RGDID: | 3552 | Length: | 165 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 45/206 - (21%) |
---|---|---|---|
Similarity: | 74/206 - (35%) | Gaps: | 85/206 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 IVLFCLLSLLACAAGQ---------RITTIHLDGVQYFISRMNPYSPELNYFL--------AYQY 51
Fly 52 CRSLGL-QLASFETKEKAESMTTYLKNAG-------YGNYD-------FWTSGNRLGTGMFLWMS 101
Fly 102 --TGLPFNATFDFFENSADAIQAGLLDPVDHNSNTSPQRTARDSSSGAEKGCVILKQPTLKWMPE 164
Fly 165 DCSAVKDFICE 175 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nw | NP_001027435.2 | CLECT | 31..176 | CDD:153057 | 34/170 (20%) |
Reg1a | NP_036773.1 | CLECT | 35..163 | CDD:295302 | 35/178 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |