DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and Reg3g

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_035390.1 Gene:Reg3g / 19695 MGIID:109406 Length:174 Species:Mus musculus


Alignment Length:195 Identity:37/195 - (18%)
Similarity:72/195 - (36%) Gaps:53/195 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKIVLFCLL----------------SLLACAAGQRITTIHLDGVQYFISRMNPYSPELNYFLAY 49
            |:.::|.||:                |..:|..|.|....:...:         :|...|::.|.
Mouse    10 MSWMLLSCLMLLSQVQGEVAKKDAPSSRSSCPKGSRAYGSYCYAL---------FSVSKNWYDAD 65

  Fly    50 QYC--RSLGLQLASFETKEKAESMTTYLKNAGYGNYDFWTSGNRLGTGMFLWMSTGLPFNATFDF 112
            ..|  |..| .|.|..:..:|..:::.:|::|             .:|.::|:....|   |..:
Mouse    66 MACQKRPSG-HLVSVLSGAEASFLSSMIKSSG-------------NSGQYVWIGLHDP---TLGY 113

  Fly   113 FENSA--DAIQAGLLDPVDHNSNTSPQRTARDSSSGAEKGCVILKQPTLKWMPEDCSAVKDFICE 175
            ..|..  :...|.:::.::..:|.|       ||||...|.:......|||....|:....::|:
Mouse   114 EPNRGGWEWSNADVMNYINWETNPS-------SSSGNHCGTLSRASGFLKWRENYCNLELPYVCK 171

  Fly   176  175
            Mouse   172  171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 29/149 (19%)
Reg3gNP_035390.1 CLECT_REG-1_like 40..172 CDD:153064 32/165 (19%)
EPN. /evidence=ECO:0000250 114..116 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.