DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and Reg3a

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_035389.1 Gene:Reg3a / 19694 MGIID:109408 Length:175 Species:Mus musculus


Alignment Length:198 Identity:40/198 - (20%)
Similarity:62/198 - (31%) Gaps:64/198 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVLFCLLSLL----------------ACAAGQRITTIHLDGVQYFISRMNPYSPELNYFLAYQYC 52
            ::|.|||.:.                :|..|.:....|.     :...|.|.|    :|.|...|
Mouse    13 MLLSCLLFVFQVQGEDFQKEVPSPRTSCPMGYKAYRSHC-----YALVMTPKS----WFQADLVC 68

  Fly    53 --RSLGLQLASFETKEKAESMTTYLKNAGYGNY-DFW------TSGNRLGTGMFLWMSTGLPFNA 108
              |..| .|.|..:..:| |..:.|.|....|| |.|      |.|.:...|.:.|.::      
Mouse    69 QKRPSG-HLVSILSGGEA-SFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNS------ 125

  Fly   109 TFDFFENSADAIQAGLLDPVDH-NSNTSPQRTARDSSSGAEKGCVILKQPTLKWMPEDCSAVKDF 172
                             |.::: |.:..|..|......|:    :......|||....|.....|
Mouse   126 -----------------DVLNYLNWDGDPSSTVNRGHCGS----LTASSGFLKWGDYYCDGTLPF 169

  Fly   173 ICE 175
            :|:
Mouse   170 VCK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 33/155 (21%)
Reg3aNP_035389.1 CLECT 40..173 CDD:295302 36/171 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.