Sequence 1: | NP_001027435.2 | Gene: | nw / 3772015 | FlyBaseID: | FBgn0283508 | Length: | 491 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035389.1 | Gene: | Reg3a / 19694 | MGIID: | 109408 | Length: | 175 | Species: | Mus musculus |
Alignment Length: | 198 | Identity: | 40/198 - (20%) |
---|---|---|---|
Similarity: | 62/198 - (31%) | Gaps: | 64/198 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 IVLFCLLSLL----------------ACAAGQRITTIHLDGVQYFISRMNPYSPELNYFLAYQYC 52
Fly 53 --RSLGLQLASFETKEKAESMTTYLKNAGYGNY-DFW------TSGNRLGTGMFLWMSTGLPFNA 108
Fly 109 TFDFFENSADAIQAGLLDPVDH-NSNTSPQRTARDSSSGAEKGCVILKQPTLKWMPEDCSAVKDF 172
Fly 173 ICE 175 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nw | NP_001027435.2 | CLECT | 31..176 | CDD:153057 | 33/155 (21%) |
Reg3a | NP_035389.1 | CLECT | 40..173 | CDD:295302 | 36/171 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |