DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and clec-262

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_507917.2 Gene:clec-262 / 191051 WormBaseID:WBGene00013831 Length:333 Species:Caenorhabditis elegans


Alignment Length:189 Identity:44/189 - (23%)
Similarity:65/189 - (34%) Gaps:55/189 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DGVQYFISRMNPY------SPELNYFL--AYQYCRSLGLQLASFETKEK-----AESMTTYLKNA 78
            ||...|:.....:      ||.::|..  |...|.::|..|:..||.::     |.::|  |..|
 Worm   149 DGWSMFVRPTTNWCLQVFGSPSVSYTQADAIHNCTNIGTVLSGLETLDERDFVAAGALT--LLGA 211

  Fly    79 GYGNY-DFWTSGNR---------------LGTGM--FLWMSTGLPFNATFDFFENSADAIQAGLL 125
            ||..: ..|.||.|               .||.|  |.:..|.:...|.:.:..|:.|....|:.
 Worm   212 GYPEFAAVWVSGMRKPECYSDGWENLAECAGTNMEQFTYTDTYMANYAGYTWDPNTPDRNSTGVW 276

  Fly   126 D----------------PVDHNSN-TSPQRTAR--DSSSGAEKGCVILKQPTLKWMPED 165
            .                |.|.|.| .|...|..  ||...:.:|....|.|.:   |.|
 Worm   277 QNCIQMWIRIESVSPDFPYDTNPNGNSDDATCNVADSDDFSLRGFACGKLPEI---PAD 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 42/185 (23%)
clec-262NP_507917.2 CW 20..113 CDD:214742
CLECT 161..325 CDD:153057 37/165 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.