DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and clec-198

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_503091.3 Gene:clec-198 / 183598 WormBaseID:WBGene00008203 Length:499 Species:Caenorhabditis elegans


Alignment Length:257 Identity:49/257 - (19%)
Similarity:78/257 - (30%) Gaps:102/257 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SLLACAAGQRITTIHLDGVQYFISRMNPYSPELNYFLAYQYCRS--LGLQLASFETKEKAESM-T 72
            |...|.:|...:|:  :|:.|.|:     :.:..::.|..:|.|  .|..|.|..::.:|:.: .
 Worm    81 STTPCDSGWTKSTV--NGMCYKIA-----TADTTWYAAEDWCYSQRYGSHLTSVHSEAEAQWIAA 138

  Fly    73 TYLKNAGYGNYD--------------FWTSGNRLGTGMFLWMSTGLPFNATFDFFENSADAIQAG 123
            ||:....:...|              .||.|..:.   :||...|.|                 |
 Worm   139 TYVSTGWFPYMDNWLGLRRSCDNSTYIWTDGTPVD---YLWWQPGYP-----------------G 183

  Fly   124 LLDPVDHNSNTSPQRTARDSSSGAEKGCVI---------------------------LKQPTLKW 161
            ..||                    ||.||.                           |..||.::
 Worm   184 SGDP--------------------EKSCVTIWVTSLLKLNPGYVQGQFDDIWDCGTNLATPTCRY 228

  Fly   162 MPEDCSA-VK---DFICEQTRCYYYNYGSIPVSSAQGRPITSTTPRTPASLMNLHVAATTTP 219
            .|...:. :|   .:.|..|...     |...:....:|.|:||  ||.:........||||
 Worm   229 DPTSTAPHIKYDTSYTCASTTTV-----STTSTVTTTKPTTTTT--TPTTTTTTPTTTTTTP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 32/192 (17%)
clec-198NP_503091.3 CLECT 85..198 CDD:214480 30/159 (19%)
CLECT 371..497 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.