DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and clec-199

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001255942.1 Gene:clec-199 / 183064 WormBaseID:WBGene00007820 Length:667 Species:Caenorhabditis elegans


Alignment Length:276 Identity:56/276 - (20%)
Similarity:85/276 - (30%) Gaps:96/276 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKIVLFCLLSLLACAAG-QRITTIHLDGVQYFISRMNPYSPELNYFLAYQYCRS--LGLQLASFE 63
            |.:||...:....||:| .|.|.   :|..|    ....||.|:::.:..:|.|  .|..|||..
 Worm    86 AGLVLADAIGTAKCASGWTRWTG---NGCCY----KEMASPMLSWYASEDWCYSQKAGAHLASVH 143

  Fly    64 TKEKAESMTTYLKNAGYGNYDF-----------------------WTSGNRLGTGMFLWMSTGLP 105
            ::.:||.:          ||.:                       ||.|..:.   |||.....|
 Worm   144 SRAEAEWL----------NYQYKLWWSKMDDWIGLRRNCDNTAWAWTDGTPVD---FLWWQPNYP 195

  Fly   106 -----------------FNATFDFFENSAD------AIQAGLLDPVDHNSN-TSPQRTARDSSSG 146
                             ....:||:....|      ...|..|...|.|:: .||          
 Worm   196 IYGGIEDSCTAMWDSTVLRGMYDFYPGQMDDGRSCTGSVAWALCKYDPNTSIISP---------- 250

  Fly   147 AEKGCVILKQPTLKWMPEDCSAVKDFICEQTRCYYYNYGSIPVSSAQGRPITSTTPRTPASLMNL 211
                         ||:..||:.........|........::|.::.. .|.|:||  ||.:....
 Worm   251 -------------KWVKADCTTTSTTTTSTTTTTTPTTTTMPTTTTT-TPTTTTT--TPTTTTTT 299

  Fly   212 HVAATTTPLPLLMSTS 227
            ....||||.....:|:
 Worm   300 PTTTTTTPTTTTETTT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 34/193 (18%)
clec-199NP_001255942.1 CLECT 99..210 CDD:214480 27/130 (21%)
CLECT 549..664 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.