DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and clec-50

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_507830.1 Gene:clec-50 / 180299 WormBaseID:WBGene00012253 Length:321 Species:Caenorhabditis elegans


Alignment Length:299 Identity:63/299 - (21%)
Similarity:98/299 - (32%) Gaps:109/299 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKIVLFCLLSLLACAAGQRITTIHLDGV---------QYFISRMNPYSPELNYFLAYQYCRSLG 56
            ||:::|. .|:|....|.|   |.:..|:         |||       :....:..|.:.|..||
 Worm     1 MARLLLL-TLALFGATAAQ---TCNTGGIYNAHFNRCYQYF-------TAPAQFEFAEEQCNLLG 54

  Fly    57 LQLASFET-KEKAESMTTYLKNAGYGNY-DFWTSGNRLGT-GMFLWMSTGLPFNATFDFFENSAD 118
            ..|||.:. :|.|...:....:....|| |:|...|.|.| |.:.|...    :.|||:      
 Worm    55 GHLASVQNGQENALLQSNAANSFKRSNYSDYWIGANDLETSGTWKWTDP----SVTFDY------ 109

  Fly   119 AIQAGLLDPVDHNSN---TSPQRTARDSSSGAEKGCVILKQPTLKWMPEDCSAVKDFICEQTRCY 180
                         ||   ..||       ||::  |.|..:....|....|::.:.::|      
 Worm   110 -------------SNWQLGEPQ-------SGSD--CAIQDKGDGTWSAIGCTSYRPYVC------ 146

  Fly   181 YYNYGSIPV-SSAQGRPITSTTPRTPASLMNLHVAATTTPLPLLMST------SGAMYTAAKAKS 238
                 ..|| .:|...|||:..|.|           ..||.|..:.|      .|..|.|     
 Worm   147 -----VTPVIMTATCPPITTPIPTT-----------CPTPAPCPVKTCVPSCDQGWTYFA----- 190

  Fly   239 SPAVGHRLIDDSSSQQQPSFMSFKLNHDRSLPDTDSTDV 277
                             |:...:::.|:....|.::..|
 Worm   191 -----------------PTDFCYRVYHNAKWEDAEAACV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 34/150 (23%)
clec-50NP_507830.1 CLECT 26..146 CDD:214480 34/158 (22%)
CLECT 182..315 CDD:214480 7/53 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.