Sequence 1: | NP_001027435.2 | Gene: | nw / 3772015 | FlyBaseID: | FBgn0283508 | Length: | 491 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503569.1 | Gene: | clec-208 / 178689 | WormBaseID: | WBGene00018097 | Length: | 223 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 39/200 - (19%) |
---|---|---|---|
Similarity: | 61/200 - (30%) | Gaps: | 76/200 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 MFLWMST--GLPFNATFDFFENSADAIQAGLLDPVDHNSNTSPQ--------------------- 137
Fly 138 -----------RTARDSSS-------GAEKG-------------CVILKQPTLK---WM-----P 163
Fly 164 EDCSAVKDFICEQTRCYYYNYGSIPVSSAQGRPITSTTPRTPASLMNLHVAATT---TPLPLLMS 225
Fly 226 TSGAM 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nw | NP_001027435.2 | CLECT | 31..176 | CDD:153057 | 25/141 (18%) |
clec-208 | NP_503569.1 | CLECT | 65..219 | CDD:153057 | 26/131 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |