DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and clec-83

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_500260.3 Gene:clec-83 / 177065 WormBaseID:WBGene00021879 Length:237 Species:Caenorhabditis elegans


Alignment Length:249 Identity:48/249 - (19%)
Similarity:88/249 - (35%) Gaps:60/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CAAGQRITTIHLDGVQYFISRMNPYSPELNYFLAYQYCRSLGLQLASFETKEKAESMTTYLK-NA 78
            ||:|..    .:..:.|.:     .:.:|:|..|..||..:...||...|..:|..:.:.:: ..
 Worm    22 CASGDN----SIGDLCYVV-----VNQQLSYQDAVGYCHGISTSLAVVHTTLQANFLASTIRTKT 77

  Fly    79 GYGNYDFWTSGNRL-GTGMFLWMSTGLPFNATFDF---FENS--ADAI----------QAGLLDP 127
            |..:..||...:|. .:..|.|....:.:.:.||.   .:|:  |:::          |..|:..
 Worm    78 GTSDSLFWIGLSRASSSSRFTWDDGSVMYWSNFDLNFPKDNNIVAESVINGKWRTLAGQQKLVFA 142

  Fly   128 VDHN-SNTSPQRTARDSSSGAEKGCVILKQPTLKWMPEDCSAVKDFICEQTRCYYYNYGSIPVSS 191
            ..:| :|.:|..|....|:.|.                          ..|...|..|.:...::
 Worm   143 CSYNPNNVNPASTTPTYSTDAS--------------------------SSTYAPYSTYATDSSTA 181

  Fly   192 AQGRPITSTTPRTPASLMNLH--VAATTTPLPLLMSTSGAMYTAAKAKSSPAVG 243
            ..|   :|.||.:..|..|.:  ..::.:|.|...|||.  |....:.|..:.|
 Worm   182 GYG---SSATPYSTDSTTNTYGPTDSSASPYPTDSSTSS--YPTDSSTSPYSTG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 28/162 (17%)
clec-83NP_500260.3 CLECT 22..143 CDD:214480 25/129 (19%)
PAP1 110..>236 CDD:369990 29/152 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.