DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and clec-117

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_493698.1 Gene:clec-117 / 173417 WormBaseID:WBGene00015193 Length:185 Species:Caenorhabditis elegans


Alignment Length:200 Identity:48/200 - (24%)
Similarity:74/200 - (37%) Gaps:41/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKIVLFCLL--SLLACAAGQRITTIHLDGVQYFISRMNPYSPELNYFLAYQYCRSLGLQLASFE 63
            |.|.:|..||  |..:.|.....|.:..:|:..|   ...|..::|:..|.::|...|..||...
 Worm     1 MLKALLPLLLWISTGSTAPAGVATYLRSNGIVAF---HKLYHLKMNFPRAKKHCEQNGAHLAGIT 62

  Fly    64 TKEKAESMTTYLKNAGYGNYDFWTSGNRLGT--GMFLW-MSTGLPFNAT------FDFFENSADA 119
            ::|:|:.:......||..|..:|..|.|.|.  ||..: ...||  |||      ..:.:|.|:.
 Worm    63 SREEAQKLIDLANEAGESNEQYWLGGQRKGECYGMRNYDKDHGL--NATCSLSNVVQWLDNVAET 125

  Fly   120 IQAGLLDP-------VDHNSNTSPQRTARDSSSGAEKGCVILKQPTLKW-MPEDCSAVKDFICEQ 176
            |     ||       ..|.....||:            |:........| .|.|...:.|..|:.
 Worm   126 I-----DPDWWKIPGPSHIPFNMPQQ------------CLSFVHGDRDWTTPNDPGFLDDIGCDV 173

  Fly   177 TRCYY 181
            .|.::
 Worm   174 PRKFF 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 38/161 (24%)
clec-117NP_493698.1 CLECT 35..179 CDD:153057 38/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.