DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and CG43055

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001245867.1 Gene:CG43055 / 12798556 FlyBaseID:FBgn0262357 Length:180 Species:Drosophila melanogaster


Alignment Length:195 Identity:41/195 - (21%)
Similarity:77/195 - (39%) Gaps:54/195 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIVLF-CLLSLLACAAGQRITTIHLDGVQYFISRMNPYSP---------------ELNYFLAYQY 51
            |:..| ..|::::.....:|:|..::||..:::  .|.:|               :.|::.|::.
  Fly     4 KLTAFSAFLAIISLCRAYQISTSVIEGVASYLN--TPTAPFVKIGDSYYFIENKLDRNWYDAFEA 66

  Fly    52 CRSLGLQLASFETKEKAESMTTYLKNAGYGNYD--FWTSGNRLG-TGMFLWMSTGLPFNATFDFF 113
            ||.:...|.:||.:::.:.:..||.:   ...|  :||:|..|. ...|:|.|.|.|..:     
  Fly    67 CRQMNADLVAFEDRKEQKLIYHYLVD---NEMDTTYWTAGTDLAEQDSFVWFSNGQPVAS----- 123

  Fly   114 ENSADAIQAGLLDPVDHNSNTSPQRTARDSSSGAEKGCVILK--QPTLKWMPED--CSAVKDFIC 174
                           |...|..|      :::..|:.||..|  .|..|....|  |:....:||
  Fly   124 ---------------DLWCNNEP------NNAKNEEHCVEYKPLHPEAKMGLNDRVCTFKTGYIC 167

  Fly   175  174
              Fly   168  167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 34/166 (20%)
CG43055NP_001245867.1 CLECT 49..167 CDD:153057 30/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.