DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and LOC110438783

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_021327622.1 Gene:LOC110438783 / 110438783 -ID:- Length:292 Species:Danio rerio


Alignment Length:153 Identity:34/153 - (22%)
Similarity:62/153 - (40%) Gaps:39/153 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LDGVQYFISRMNPYSPELNYFLAYQYCRSLGLQLASFETKEKAESMTTYLKNAGYGNYDFWTSGN 90
            |||   |.|.|:    ..|:..:.::||:||..|...:::::.:.::.::|              
Zfish   176 LDG---FSSSMD----VKNWSDSREFCRNLGADLVMIKSEDRQKRISYFVK-------------- 219

  Fly    91 RLGTGMFLWMS-TGLPFNATFDFFENSADAIQAGLLDPVDHNSNTSPQRTARDSSSGAEKGCVIL 154
             :..|..:|:. |......:..:.:||  |:..|.....:.|:|            ...:.||.:
Zfish   220 -VKIGAPVWLGLTDTEIEGSMMWVDNS--ALNQGFWMKGEPNNN------------DGNEDCVFM 269

  Fly   155 KQ-PTLK-WMPEDCSAVKDFICE 175
            .. |:|| |....||.|...|||
Zfish   270 NPIPSLKNWNDIPCSEVARVICE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 31/148 (21%)
LOC110438783XP_021327622.1 CLECT_DC-SIGN_like 179..292 CDD:153060 29/145 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.