DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and LOC103911722

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_009303414.1 Gene:LOC103911722 / 103911722 -ID:- Length:674 Species:Danio rerio


Alignment Length:219 Identity:50/219 - (22%)
Similarity:82/219 - (37%) Gaps:35/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 RSLPDTDSTDVDVEDQEADLDGEEHDDHEAE----------GEEE---HDEHDNFEEHARELSND 318
            |.|| |:.|::: |::|..|........|.|          ||.|   :..:|..:|..:.|:.:
Zfish    76 RHLP-TNITNLN-EEREKILKRSNELTEEREQLLTNITNLKGERERLLNHNNDLTKEREQILNRN 138

  Fly   319 NDGDIKEHVFPLSDNELHPEVHSIEEVQQQLQQEDADADSAPAPAAAEDNESSQHDAEADGEHEQ 383
            ||...:......|.|:|..|...|.:....|.:|.............|..:..:.:.:...|.||
Zfish   139 NDLTKEREQILKSKNDLTKEREQILKNNNDLTKEREQILKRNNDLTKEKEQILKRNNDLTKEREQ 203

  Fly   384 DGAEGETDLENETPVDLIKANEPLAMPSSTESPAAAIEERIKQIAQDFQKMASSQELQPKEELTP 448
            . .:...||..|.. .|:|.|..|...          :|:|.:...|..| ...|.|:...:||.
Zfish   204 I-LKNNNDLTKERE-QLLKRNNDLTKE----------KEQILKRNNDLTK-EREQILKNNNDLTK 255

  Fly   449 QSSLSL---NDLIRTLRPNEQQII 469
            :....|   |||.:    .::||:
Zfish   256 EKEQILKRNNDLTK----EKEQIL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057
LOC103911722XP_009303414.1 COG1340 210..505 CDD:224259 21/82 (26%)
CLECT_NK_receptors_like 562..669 CDD:153063
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.