DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and Clec19a

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_038953831.1 Gene:Clec19a / 100909498 RGDID:6503302 Length:234 Species:Rattus norvegicus


Alignment Length:86 Identity:20/86 - (23%)
Similarity:32/86 - (37%) Gaps:28/86 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 PVDLIKANEPLAMPSSTESPAAAIEERIKQIAQDFQKMASSQELQPKEELTPQSSLSLNDLIRTL 461
            |::.|.|...:..|..|.|..:|             ||.|   :...||     |:.:.||:.: 
  Rat    59 PINKIWAEANIHCPQFTASRKSA-------------KMVS---IHSWEE-----SVFVYDLVNS- 101

  Fly   462 RPNEQQIIPQIDSDYSNAMRV 482
                  .:|.|.:|....:||
  Rat   102 ------CVPDIPADTCMGLRV 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057
Clec19aXP_038953831.1 CLECT 49..194 CDD:413318 20/86 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.