DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and LOC100537143

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_009293464.2 Gene:LOC100537143 / 100537143 -ID:- Length:307 Species:Danio rerio


Alignment Length:146 Identity:24/146 - (16%)
Similarity:50/146 - (34%) Gaps:44/146 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YSPELNYFLAYQYCRSLGLQLASFETKEKAESMTTYLKNAGYGNYDFWTSGNRLGT-GMFLWMST 102
            ::.|.::..:.|:||:.|.:|...:::.|...:::.:|.      |.|...:...| |...|:..
Zfish   198 FTEEKSWSESRQFCRNRGAELVIIKSEVKQRVISSLVKE------DVWIGLSDTETEGTMKWVDN 256

  Fly   103 GLPFNATF-------DFFENSADAIQAGLLDPVDHNSNTSPQRTARDSSSGAEKGCVILKQPTLK 160
            . |.|..|       ::.....|.::..:...:.:|                             
Zfish   257 S-PMNQGFWARGEPNNYLNLDEDCVEVRISQGIPNN----------------------------- 291

  Fly   161 WMPEDCSAVKDFICEQ 176
            |....||..:..|||:
Zfish   292 WNDLRCSDRRKGICEK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 23/144 (16%)
LOC100537143XP_009293464.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.