DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and LOC100487836

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_017948017.1 Gene:LOC100487836 / 100487836 -ID:- Length:383 Species:Xenopus tropicalis


Alignment Length:148 Identity:31/148 - (20%)
Similarity:52/148 - (35%) Gaps:45/148 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YFISRMNPYSPELNYFLAYQYCRSLGLQLASFETKEKAESMTTYLKNAGYGNYDFWTSGNRLGTG 95
            ||.|:    .|: ::..:.|.|:.||..|..|..:.:.:::..|::|.     .||....|....
 Frog   273 YFFSK----EPK-SWADSRQQCQKLGSDLLIFTDQAEVDALYQYMQNK-----RFWIGLQRNKDQ 327

  Fly    96 MFLWM-STGLPFNATFDFFENSADAIQAGLLDPVDHNSNTSPQRTARDSSSGAEKGCVILKQPTL 159
            .:.|: ...|.||.                            ..|...:::|:.:.|    ..||
 Frog   328 KWNWVDGKALTFNR----------------------------WGTGEPNNAGSGEHC----GETL 360

  Fly   160 K--WMPEDCSAVKDFICE 175
            .  |....|..:.|||||
 Frog   361 SRYWNDLKCGDIIDFICE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 31/148 (21%)
LOC100487836XP_017948017.1 EnvC 165..>257 CDD:227278
CLECT_DC-SIGN_like 261..378 CDD:153060 29/146 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.