DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nw and si:ch211-125e6.11

DIOPT Version :9

Sequence 1:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001124136.1 Gene:si:ch211-125e6.11 / 100170830 ZFINID:ZDB-GENE-070912-35 Length:146 Species:Danio rerio


Alignment Length:141 Identity:27/141 - (19%)
Similarity:52/141 - (36%) Gaps:36/141 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YSPELNYFLAYQYCRSLGLQLASFETKEKAESMTTYLKNAGYGNYDFWTSGNRLG--TGMFLWMS 101
            :|..:::..|.:.|:..|..|||...:.:.:    :|.|....:...|..|:. |  .|.:||..
Zfish    37 FSQSVSWITAEKNCQGFGGNLASVHNRLEND----FLMNMVPSSSRCWIGGHD-GEQEGQWLWTD 96

  Fly   102 TGLPFNATFDFFENSADAIQAGLLDPVDHNSNTSPQRTARDSSSGAEKGCVILKQPTLK-WMPED 165
                 .:.||:....:|       :|.:..|                :.|:.:...:.. |..:.
Zfish    97 -----GSMFDYNNWCSD-------EPNNQRS----------------ENCMEINWTSNHCWNDQG 133

  Fly   166 CSAVKDFICEQ 176
            ||....|:||:
Zfish   134 CSTSMGFMCER 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nwNP_001027435.2 CLECT 31..176 CDD:153057 26/139 (19%)
si:ch211-125e6.11NP_001124136.1 CLECT 32..144 CDD:153057 26/139 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.