DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17768 and LSM4

DIOPT Version :9

Sequence 1:NP_001027236.1 Gene:CG17768 / 3772012 FlyBaseID:FBgn0032240 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_011037.3 Gene:LSM4 / 856848 SGDID:S000000914 Length:187 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:54/164 - (32%)
Similarity:77/164 - (46%) Gaps:32/164 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSK----------DGDRFWR 55
            ||||.||..|:...|.:||||||...|.|.:.|:|||:.|.:|...|:          :..:..:
Yeast     1 MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAINSEDNAESSKAVK 65

  Fly    56 MPECYIRGSTIKYLRIPDEVIDMVKEDAQAKSRNRTEMNKNRGGNSSQNQRGGRPGGGNRNNVGN 120
            :.|.||||:.||::::.|.:||.||:  |..|.|    |.|..|...:.....|....||.|...
Yeast    66 LNEIYIRGTFIKFIKLQDNIIDKVKQ--QINSNN----NSNSNGPGHKRYYNNRDSNNNRGNYNR 124

  Fly   121 RPGQGYGGAANNAMRLGGAAGQGNRLPHAAKNRK 154
            |..       ||        |..||.|: ::||:
Yeast   125 RNN-------NN--------GNSNRRPY-SQNRQ 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17768NP_001027236.1 LSm4 2..77 CDD:212470 30/84 (36%)
LSM4NP_011037.3 LSm4 2..87 CDD:212470 30/84 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344126
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3293
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I1656
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55325
OrthoFinder 1 1.000 - - FOG0005075
OrthoInspector 1 1.000 - - oto99435
orthoMCL 1 0.900 - - OOG6_102392
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R668
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.690

Return to query results.
Submit another query.